The current invention concerns SMAD interacting protein(s) obtainable by a two-hybrid screening assay whereby SMAD1 C-domain fused to GAL4 DNA-binding domain as bait and a cDNA library from mouse embryo as prey are used. Some characteristics of a specific SMAD interacting protein (SIP1) of the family of zinc finger/homeodomain proteins including .delta.-crystallin enhancer binding protein and/or Drosophila zfh-1 include an inability to interact with full size XSMAD1 in yeast, SIP1.sub.czf binds to E2 box sites, SIP1.sub.czf binds to the Brachyury protein binding site and interferes with Brachyury-mediated transcription activation in cells and also interacts with C-domain of SMAD 1, 2 and 5. The minimal length of the amino acid sequence necessary for binding with SMAD appears to be a 51 amino acid domain encompassing amino acids 166-216 of SEQ ID NO 2 having the amino acid sequence as depicted in the one letter code: QHLGVGMEAPLLGFPTMNSNLSEVQKVLQIVDNTVSRQKMDCKTEDISKLK (SEQ ID NO. 21).

De huidige uitvinding betreft SMAD op elkaar inwerken eiwit(s) verkrijgbaar door een twee-hybride onderzoeksanalyse waardoor het c-Domein SMAD1 aan GAL4 DNA-Bindend domein als aas en een bibliotheek DNA van muisembryo smolt aangezien de prooi wordt gebruikt. Sommige kenmerken van een specifieke op elkaar inwerkende proteïne SMAD (SIP1) van de familie van zinkvinger/homeodomain proteïnen met inbegrip van delta.-crystallin omvatten versterkers bindend proteïne en/of Fruitvliegje zfh-1 een onvermogen om met volledige grootte XSMAD1 in gist in wisselwerking te staan, bindt SIP1.sub.czf aan E2 doosplaatsen, bindt SIP1.sub.czf aan de Brachyury eiwitbandplaats en mengt zich in brachyury-Bemiddelde transcriptieactivering in cellen en staat ook met c-Domein van SMAD 1..2 en 5 in wisselwerking. De minimale lengte van de aminozuuropeenvolging noodzakelijk voor band met SMAD schijnt een 51 aminozuurdomein te zijn dat aminozuren 166-216 van SEQ identiteitskaart nr dat 2 omringt de aminozuuropeenvolging heeft zoals die in de één brievencode wordt afgeschilderd: QHLGVGMEAPLLGFPTMNSNLSEVQKVLQIVDNTVSRQKMDCKTEDISKLK (SEQ IDENTITEITSKAART NR. 21).

 
Web www.patentalert.com

< (none)

< Isolated DNA sequence which can serve as terminator region in a chimeric gene capable of being used for the transformation of plants

> Soy proteins and methods for their production

> (none)

~ 00019