A method of inducing cytostasis in a population of HIV-infected cells is disclosed which comprises applying to a population of HIV-infected cells a cytostatically effective amount of an inhibitor comprising an isolated peptide having the amino acid sequence FCRFLLCPSRTSD or SQCEQEGGRCRFLLCPSRTSNIGKLGCEPLWKC CKRWGG, or a conservative variant thereof, whereby cell growth in at least a portion of the HIV-infected cells is arrested, rendering the growth-arrested cells non-HIV producing. The peptide may be conjugated with an agent that is capable of selectively targeting HIV-infected cells.

 
Web www.patentalert.com

< Use of human stem cells and/or factors they produce to promote adult mammalian cardiac repair through cardiomyocyte cell division

< Rasgap derived peptide for selectively killing cancer cells

> Inducible plasmid vector encoding tgf-beta and use thereof

> Inhibition of the cd95 ligand/receptor system for the treatment of neurological disorders and injuries
~ 00296